PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G206600.1
Common NameB456_001G206600, LOC105771440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 285aa    MW: 31998.6 Da    PI: 9.3582
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G206600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.43.8e-29197251256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         +r+ W+p+LH+rFve ++ LGG  +AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Gorai.001G206600.1 197 NRRSWSPQLHARFVETLHILGGMYEATPKQIREMMNVDGLTNDQVKSHLQKYRLH 251
                         799**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.529193253IPR017930Myb domain
SuperFamilySSF466894.66E-17194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-25195254IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-23196251IPR006447Myb domain, plants
PfamPF002497.7E-7198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MASSSNSLGL KLSLKPTYVP KTITDLMKDL LNIENETDKL AVLSDYISQH EEELNSIAAL  60
RGQLPQCMLL LMEALGTLRQ EFLKIKNGMV AGKEGDNIDM VLKENSGMKR KRCEKMLEAE  120
QVPNLKCDFK GKGVMMNSSP PHHPSNHKHP KAFRDFVQAP NQNPNSNGGG GLNLRADNRT  180
LLNYKHKPLT QPIWKNNRRS WSPQLHARFV ETLHILGGMY EATPKQIREM MNVDGLTNDQ  240
VKSHLQKYRL HSRKQQEGCA QQVAKGEDPW DPDRDGGEPM APAN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6224503e-52JX622450.1 Gossypium hirsutum clone NBRI_GE69182 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448367.10.0PREDICTED: uncharacterized protein LOC105771440
TrEMBLA0A0D2NC930.0A0A0D2NC93_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15410716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-23G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]